Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in molybdenum cofactor biosynthesis.
ProductProbable molybdenum cofactor biosynthesis protein D 2 MoaD2 (molybdopterin converting factor small subunit) (molybdopterin [MPT] converting factor, subunit 1)
CommentsRv0868c, (MTV043.61c), len: 92 aa. Probable moaD2, molybdenum cofactor biosynthesis protein (molybdopterin converting factor (subunit 1)), similar to CAB88494.1|AL353816 putative molybdopterin converting factor from Streptomyces coelicolor (84 aa); and weakly similar to others MoaD proteins e.g. Z99111|BSUB0008_103 from Bacillus subtilis (77 aa), FASTA scores: opt: 86, E(): 2.8, (22.9% identity in 83 aa overlap); etc. Also some similarity with Rv3112|MOAD1|MTCY164.22 putative molybdenum cofactor biosynthesis protein D from Mycobacterium tuberculosis (83 aa), FASTA scores: opt: 113, E(): 0.024, (31.3% identity in 83 aa overlap).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS965983966261-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0868c|moaD2
VTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG