Gene Mb0940c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe7 |
| Comments | Mb0940c, PE7, len: 99 aa. Equivalent to Rv0916c,len: 99 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 99 aa overlap). Member of the Mycobacterium tuberculosis PE family, similar to many e.g. Rv1788 from Mycobacterium tuberculosis (99 aa), FASTA scores: opt: 321, E(): 1.3e-11, (53.5% identity in 99 aa overlap); etc. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1021810 | 1022109 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0940c|PE7
MSFVTIQPVVLAAATGDLPTIGTAVSARNTAVCAPTTGVLPPAANDVSVLTAARFTAHTKHYRVVSKPAALVHGMFVALPAATADAYATTEAVNVVATG
Bibliography
No article yet recorded