Gene Rv0916c (MTB10)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE7 |
| Comments | Rv0916c, (MTCY21C12.10c), len: 99 aa. PE7 (alternate gene name: MTB10). Member of the Mycobacterium tuberculosis PE family (see citations below), similar to many e.g. Rv1788 from Mycobacterium tuberculosis (99 aa), FASTA scores: opt: 321, E(): 1.3e-11, (53.5% identity in 99 aa overlap); etc. |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1021344 | 1021643 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0916c|PE7
MSFVTIQPVVLAAATGDLPTIGTAVSARNTAVCAPTTGVLPPAANDVSVLTAARFTAHTKHYRVVSKPAALVHGMFVALPAATADAYATTEAVNVVATG
Bibliography
- Skeiky YA et al. [2000]. T cell expression cloning of a Mycobacterium tuberculosis gene encoding a protective antigen associated with the early control of infection. Product
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
