Gene Mb0962c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | dna end-binding protein, mku |
Comments | Mb0962c, -, len: 273 aa. Equivalent to Rv0937c,len: 273 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 273 aa overlap). Conserved hypothetical protein, highly similar to others e.g. SC6G9.24c|T35620|AL079356 hypothetical protein from Streptomyces coelicolor (365 aa), FASTA scores: opt: 648,E(): 0, (36.5% identity in 274 aa overlap); Z99110|BSUB0007_223|NP_389224.1|NC_000964 hypothetical proteins from Bacillus subtilis (311 aa), FASTA scores: opt: 623, E(): 1.1e-31, (33.9% identity in 274 aa overlap); O28548|AE000984|AF1726|NP_070554.1|NC_000917 conserved hypothetical protein from Archaeoglobus fulgidus (286 aa), FASTA scores: opt: 583, E(): 0, (36.6% identity in 262 aa overlap); etc. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1045666 | 1046487 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0962c|mku MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDLARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSKSYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPVLDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPRLLDEPEDVSDLLAKLEASVKARSKANSNVPTPP
Bibliography
No article yet recorded