Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in DNA double-strand break repair, by nonhomologous end joining (NHEJ). Interacts with LIGD (Rv0938).
ProductDNA end-binding protein, Mku
CommentsRv0937c, (MTCY08D9.02), len: 273 aa. Mku, DNA end-binding protein, highly similar to others e.g. SC6G9.24c|T35620|AL079356 hypothetical protein from Streptomyces coelicolor (365 aa), FASTA scores: opt: 648, E(): 0, (36.5% identity in 274 aa overlap); Z99110|BSUB0007_223|NP_389224.1|NC_000964 hypothetical proteins from Bacillus subtilis (311 aa), FASTA scores: opt: 623, E(): 1.1e-31, (33.9% identity in 274 aa overlap); O28548|AE000984|AF1726|NP_070554.1|NC_000917 conserved hypothetical protein from Archaeoglobus fulgidus (286 aa), FASTA scores: opt: 583, E(): 0, (36.6% identity in 262 aa overlap); etc.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10451991046020-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0937c|mku
MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDLARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSKSYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPVLDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPRLLDEPEDVSDLLAKLEASVKARSKANSNVPTPP