Gene Rv0937c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in DNA double-strand break repair, by nonhomologous end joining (NHEJ). Interacts with LIGD (Rv0938). |
| Product | DNA end-binding protein, Mku |
| Comments | Rv0937c, (MTCY08D9.02), len: 273 aa. Mku, DNA end-binding protein, highly similar to others e.g. SC6G9.24c|T35620|AL079356 hypothetical protein from Streptomyces coelicolor (365 aa), FASTA scores: opt: 648, E(): 0, (36.5% identity in 274 aa overlap); Z99110|BSUB0007_223|NP_389224.1|NC_000964 hypothetical proteins from Bacillus subtilis (311 aa), FASTA scores: opt: 623, E(): 1.1e-31, (33.9% identity in 274 aa overlap); O28548|AE000984|AF1726|NP_070554.1|NC_000917 conserved hypothetical protein from Archaeoglobus fulgidus (286 aa), FASTA scores: opt: 583, E(): 0, (36.6% identity in 262 aa overlap); etc. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1045199 | 1046020 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0937c|mku
MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDLARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSKSYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPVLDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPRLLDEPEDVSDLLAKLEASVKARSKANSNVPTPP
Bibliography
- Weller GR et al. [2002]. Identification of a DNA nonhomologous end-joining complex in bacteria. Function Product
- Della M et al. [2004]. Mycobacterial Ku and ligase proteins constitute a two-component NHEJ repair machine. Function Product
- Pitcher RS et al. [2005]. Domain structure of a NHEJ DNA repair ligase from Mycobacterium tuberculosis. Biochemistry Function
- Gong C et al. [2005]. Mechanism of nonhomologous end-joining in mycobacteria: a low-fidelity repair system driven by Ku, ligase D and ligase C. Function Mutant
- Malyarchuk S et al. [2007]. Expression of Mycobacterium tuberculosis Ku and Ligase D in Escherichia coli results in RecA and RecB-independent DNA end-joining at regions of microhomology. Biochemistry
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
