Gene Mb0991c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0991c, -, len: 200 aa. Equivalent to Rv0966c,len: 200 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 200 aa overlap). Conserved hypothetical protein, equivalent to AL035500|MLCL373_12 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium leprae (200 aa),FASTA scores: opt: 1080, E(): 0, (79.5% identity in 200 aa overlap). Also highly similar to SCE6.30c|CAB88834.1|AL353832 hypothetical protein from Streptomyces coelicolor (277 aa). Some similarity to Rv2862c|MTV007.08 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (194 aa), FASTA scores: E(): 3.1e-06, (31.5% identity in 184 aa overlap). Equivalent to AAK45243.1 from Mycobacterium tuberculosis strain CDC1551 (230 aa) but shorter 30 aa. Note that Rv0966c has been shortened since first entry. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1077672 | 1078274 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0991c|Mb0991c
MSNSAQRDARNSRDESARASDTDRIQIAQLLAYAAEQGRLQLTDYEDRLARAYAATTYQELDRLRADLPGAAIGPRRGGECNPAPSTLLLALLGGFERRGRWNVPKKLTTFTLWGSGVLDLRYADFTSTEVDIRAYSIMGAQTILLPPEVNVEIHGHRVMGGFDRKVVGEGTRGAPTVRIRGFSLGGDVGIKRKPRKPRK
Bibliography
No article yet recorded
