Gene Mb1043c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l25 rply |
Comments | Mb1043c, rplY, len: 215 aa. Equivalent to Rv1015c,len: 215 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 215 aa overlap). Probable rplY, 50s ribosomal protein L25, similar to RL25_ECOLI|P02426 50s ribosomal protein L25 from Escherichia coli (94 aa), FASTA scores: opt: 182, E(): 2.5e-05, (38.4% identity in 86 aa overlap) and to CTC_BACSU|P14194 general stress protein from Bacillus subtilis (203 aa), FASTA scores: opt: 260,E(): 1.4e-09, (28.4% identity in 201 aa overlap). BELONGS TO THE L25P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1134373 | 1135020 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1043c|rplY MAKSASNQLRVTVRTETGKGASRRARRAGKIPAVLYGHGAEPQHLELPGHDYAAVLRHSGTNAVLTLDIAGKEQLALTKALHIHPIRRTIQHADLLVVRRGEKVVVEVSVVVEGQAGPDTLVTQETNSIEIEAEALSIPEQLTVSIEGAEPGTQLTAGQIALPAGVSLISDPDLLVVNVVKAPTAEELEGEVAGAEEAEEAAVEAGEAEAAGESE
Bibliography
No article yet recorded