Gene Mb1057
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable membrane protein kdpF |
Comments | Mb1057, kdpF, len: 30 aa. Equivalent to Rv1028A,len: 30 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 30 aa overlap). Probable kdpF, membrane protein, showing similarity with P36937|KDPF_ECOLI|B0698.1 PROTEIN KDPF from Escherichia coli strain K12 (see citation below) (27% identity); and KdpF protein from Streptomyces coelicolor (51% identity). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1152367 | 1152459 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1057|kdpF MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Bibliography
No article yet recorded