Gene Mb1109c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | PROBABLE TRANSCRIPTION ELONGATION FACTOR GREA (Transcript cleavage factor greA) | 
| Comments | Mb1109c, greA, len: 164 aa. Equivalent to Rv1080c,len: 164 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 164 aa overlap). Probable greA,transcription elongation factor G, closest to P46808|GREA_MYCLE TRANSCRIPTION ELONGATION FACTOR G from Mycobacterium leprae (202 aa), FASTA scores: opt: 1005,E(): 0, (94.5% identity in 164 aa overlap); and similar to many e.g. P21346|GREA_ECOLI from Escherichia coli (158 aa), FASTA scores: opt: 257, E(): 5.7e-10, (37.2% identity in 148 aa overlap); etc. Contains two PS00829 and one PS00830 Prokaryotic transcription elongation factors signatures 1 and 2, respectively. BELONGS TO THE GREA/GREB FAMILY. | 
| Functional category | |
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1206664 | 1207158 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1109c|greA
MTDTQVTWLTQESHDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLSNAKVGEAPKQSGVALPGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSTVSVTLVSAEPYHS
      
    Bibliography
    No article yet recorded