Gene Mb1109c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSCRIPTION ELONGATION FACTOR GREA (Transcript cleavage factor greA) |
| Comments | Mb1109c, greA, len: 164 aa. Equivalent to Rv1080c,len: 164 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 164 aa overlap). Probable greA,transcription elongation factor G, closest to P46808|GREA_MYCLE TRANSCRIPTION ELONGATION FACTOR G from Mycobacterium leprae (202 aa), FASTA scores: opt: 1005,E(): 0, (94.5% identity in 164 aa overlap); and similar to many e.g. P21346|GREA_ECOLI from Escherichia coli (158 aa), FASTA scores: opt: 257, E(): 5.7e-10, (37.2% identity in 148 aa overlap); etc. Contains two PS00829 and one PS00830 Prokaryotic transcription elongation factors signatures 1 and 2, respectively. BELONGS TO THE GREA/GREB FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1206664 | 1207158 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1109c|greA
MTDTQVTWLTQESHDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLSNAKVGEAPKQSGVALPGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSTVSVTLVSAEPYHS
Bibliography
No article yet recorded