Gene Mb1117
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe9 |
| Comments | Mb1117, PE9, len: 144 aa. Equivalent to Rv1088,len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 144 aa overlap). Member of Mycobacterium tuberculosis PE family, similar to many others e.g. Z96071|MTCI418B_6 Mycobacterium tuberculosis cosmid (487 aa), FASTA scores: opt: 318, E(): 7.3e-14, (60.9% identity in 87 aa overlap) - except it appears to be frameshifted around codon 84. No error to account for frameshift could be found. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1215894 | 1216328 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1117|PE9
MSYMIATPAALTAAATDIDGIGSAVSVANAAAVAATTGVLAAGGDEVLAAIARLFNANAEEYHALSAQVAAFQTLFVRTLTGGCGVFRRRRGRQCVTAAEHRAAGAGRRQRRRRSGDGQWRLRQQRHFGCGGQPEFRQHSEHRR
Bibliography
No article yet recorded