Gene Mb1126
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE GLYCOSYL HYDROLASE |
| Comments | Mb1126, -, len: 291 aa. Equivalent to Rv1096, len: 291 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 291 aa overlap). Possible glycosyl hydrolase (EC 3.-.-.-), possibly a deacetylase or esterase. Equivalent to AL049491|MLCB1222_13 Mycobacterium leprae (291 aa) (81.3% identity in 289 aa overlap). Similar at the C-terminus of enzymes involved in carbohydrate degradation including Z99110|BSUB0007_92 endo-1,4-beta-xylanase homolog yjeA from Bacillus subtilis (467 aa), FASTA scores: opt: 418, E(): 2.6e-17, (38.6% identity in 184 aa overlap); M64552|STMXLNB_2 acetyl-xylan esterase from Streptomyces lividans (335 aa), FASTA scores: opt: 371, E(): 1.1e-14, (31.6% identity in 237 aa overlap); NP_345933.1|NC_003028 peptidoglycan N-acetylglucosamine deacetylase A from Streptococcus pneumoniae (463 aa); etc. Has possible N-terminal signal sequence with TMhelix at aa 13-31. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1225757 | 1226632 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1126|Mb1126
MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVALTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGMEIGSHTWEHPNMTTIPPEDIPGQFSRANDVIAAATGRTPTLYRPAGGLSNDAVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHDTYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNELRDIPASEIPPLPNTSSPKPMSNFPITDIAGQNSGGPNNGA
Bibliography
No article yet recorded