Gene Rv1096
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably involved in carbohydrate degradation. May hydrolyse the glycosidic bond between two or more carbohydrates or between a carbohydrate and a non-carbohydrate moiety. |
| Product | Possible glycosyl hydrolase |
| Comments | Rv1096, (MTV017.49), len: 291 aa. Possible glycosyl hydrolase, possibly deacetylase or esterase. Equivalent to AL049491|MLCB1222_13 Mycobacterium leprae (291 aa) (81.3% identity in 289 aa overlap). Similar at the C-terminus to enzymes involved in carbohydrate degradation including Z99110|BSUB0007_92 endo-1,4-beta-xylanase homolog yjeA from Bacillus subtilis (467 aa), FASTA scores: opt: 418, E(): 2.6e-17, (38.6% identity in 184 aa overlap); M64552|STMXLNB_2 acetyl-xylan esterase from Streptomyces lividans (335 aa), FASTA scores: opt: 371, E(): 1.1e-14, (31.6% identity in 237 aa overlap); NP_345933.1|NC_003028 peptidoglycan N-acetylglucosamine deacetylase a from Streptococcus pneumoniae (463 aa); etc. Has possible N-terminal signal sequence with TMhelix at aa 13-31. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Essential gene for in vitro growth of H37Rv on cholesterol, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1224385 | 1225260 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1096|Rv1096
VPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVALTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGMEIGSHTWEHPNMTTIPPEDIPGQFSRANDVIAAATGRTPTLYRPAGGLSNDAVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHDTYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNELRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- González-Zamorano M et al. [2009]. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant