Gene Mb1137c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable exodeoxyribonuclease VII (small subunit) xseB (Exonuclease VII small subunit) |
Comments | Mb1137c, xseB, len: 85 aa. Equivalent to Rv1107c,len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 85 aa overlap). Probable xseB,exonuclease VII small subunit (EC 3.1.11.6). Equivalent to AL049491|MLCB1222_6 Mycobacterium leprae (87 aa) (77.9% identity in 68 aa overlap). Similar to P43914|EX7S_HAEIN EXODEOXYRIBONUCLEASE SMALL SUBUNIT from H. influenzae (84 aa), FASTA scores: opt: 126, E(): 0.006, (37.3% identity in 67 aa overlap); and P22938|EX7S_ECOLI EXODEOXYRIBONUCLEASE SMALL SUBUNIT from Escherichia coli (79 aa), FASTA scores: opt: 125, E(): 0.0067, (39.7% identity in 58 aa overlap). BELONGS TO THE XSEB FAMILY. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1235337 | 1235594 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1137c|xseB MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVSDVLAGDEAQNG
Bibliography
No article yet recorded