Gene Mb1143
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb32 |
| Comments | Mb1143, -, len: 65 aa. Equivalent to Rv1113, len: 65 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 65 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical protein Rv2758c|AL00896 7|MTV002.23 (88 aa) FASTA scores: opt: 97, E(): 0.86, (33.3% identity in 69 aa overlap). Part of family including Rv2871, Rv1241, Rv2132,Rv3321c, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1240787 | 1240984 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1143|vapb32
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR
Bibliography
No article yet recorded