Gene Rv1113
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB32 |
| Comments | Rv1113, (MTCY22G8.02), len: 65 aa. Possible vapB32, antitoxin, part of toxin-antitoxin (TA) operon with Rv1114, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis e.g. Rv2758c|AL00896 7|MTV002.23 (88 aa) FASTA scores: opt: 97, E(): 0.86, (33.3% identity in 69 aa overlap). Part of family including Rv2871, Rv1241, Rv2132, Rv3321c, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1239416 | 1239613 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1113|vapB32
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
