Gene Mb1202c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein. possible lipase lipx. |
| Comments | Mb1202c, PE11, len: 100 aa. Equivalent to Rv1169c,len: 100 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 100 aa overlap). Member of the Mycobacterium tuberculosis PE family of proteins (see second citation below), e.g. O05297|Z93777|MTCI364.07 (99 aa), FASTA scores: opt: 209, E(): 1.6e-15, (37.4% identity in 99 aa overlap). Also simlar to the N-terminus of P77909|U76006 ESTERASE/LIPASE (EC 3.1.1.3) from Mycobacterium tuberculosis (437 aa), FASTA scores: opt: 193, E(): 4.4e-14, (37.2% identity in 94 aa overlap). Contains a helix-turn-helix motif from aa 88-109 (+2.76 SD). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1301195 | 1301497 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1202c|lipx
MSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST
Bibliography
No article yet recorded