Gene Rv1169c (PE11)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein. Possible lipase LipX. |
| Comments | Rv1169c, (MTV005.05c), len: 100 aa. Possible lipX, lipase. Member of the Mycobacterium tuberculosis PE family of proteins (see Brennan & Delogu 2002), e.g. O05297|Z93777|MTCI364.07 (99 aa), FASTA scores: opt: 209, E(): 1.6e-15, (37.4% identity in 99 aa overlap). Also simlar to the N-terminus of P77909|U76006 esterase/lipase from Mycobacterium tuberculosis (437 aa), FASTA scores: opt: 193, E(): 4.4e-14, (37.2% identity in 94 aa overlap). Contains a helix-turn-helix motif from aa 88-109 (+2.76 SD). Predicted possible vaccine candidate (See Zvi et al., 2008). |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis: transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002), up-regulated at high temperatures (see Stewart et al., 2002), and also up-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1299822 | 1300124 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1169c|lipX
VSFVTTRPDSIGETAANLHEIGVTMSAHDDGVTPLITNVESPAHDLVSIVTSMLFSMHGELYKAIARQAHVIHESFVQTLQTSKTSYWLTELANRAGTST
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Deb C, Daniel J, Sirakova TD, Abomoelak B, Dubey VS and Kolattukudy PE [2006]. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. Product Transcriptome
- Zvi A et al. [2008]. Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. Immunology
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant