Gene Mb1242
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable dna-3-methyladenine glycosylase i taga (tag i) (3-methyladenine-dna glycosylase i, constitutive) (dna-3-methyladenine glycosidase i) |
| Comments | Mb1242, tagA, len: 204 aa. Equivalent to Rv1210,len: 204 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 204 aa overlap). Probable tagA,DNA-3-methyladenine glycosidase I (EC 3.2.2.20), similar to several e.g. 3MG1_ECOLI|P05100 DNA-3-methyladenine glycosidase I from Escherichia coli (187 aa), FASTA scores: opt: 530, E(): 1.3e-27, (44.2% identity in 190 aa overlap). Also similar to Q49957 Mycobacterium leprae cosmid B1756 (192 aa), FASTA scores: opt: 1042, E(): 0,(80.2% identity in 192 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1354769 | 1355383 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1242|tagA
MSGDGLVRCPWAEVRPGPDAQLYRDYHDNEWGRPLYGRVALFERMSLEAFQSGLSWLIILRKRENFRRAFSGFDIDKIARYTDTDVRRLLADDGIVRNRAKIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSVSTESKAMSRELKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFDQPGCPMAAR
Bibliography
No article yet recorded