Gene Mb1242 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | probable dna-3-methyladenine glycosylase i taga (tag i) (3-methyladenine-dna glycosylase i, constitutive) (dna-3-methyladenine glycosidase i) | 
| Comments | Mb1242, tagA, len: 204 aa. Equivalent to Rv1210,len: 204 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 204 aa overlap). Probable tagA,DNA-3-methyladenine glycosidase I (EC 3.2.2.20), similar to several e.g. 3MG1_ECOLI|P05100 DNA-3-methyladenine glycosidase I from Escherichia coli (187 aa), FASTA scores: opt: 530, E(): 1.3e-27, (44.2% identity in 190 aa overlap). Also similar to Q49957 Mycobacterium leprae cosmid B1756 (192 aa), FASTA scores: opt: 1042, E(): 0,(80.2% identity in 192 aa overlap). | 
| Functional category | Information pathways | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1354769 | 1355383 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1242|tagA
MSGDGLVRCPWAEVRPGPDAQLYRDYHDNEWGRPLYGRVALFERMSLEAFQSGLSWLIILRKRENFRRAFSGFDIDKIARYTDTDVRRLLADDGIVRNRAKIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSVSTESKAMSRELKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFDQPGCPMAAR
      
    Bibliography
    No article yet recorded