Gene Rv1210
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in base excision repair. Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine from the damaged DNA polymer formed by alkylation lesions |
| Product | Probable DNA-3-methyladenine glycosylase I TagA (tag I) (3-methyladenine-DNA glycosylase I, constitutive) (DNA-3-methyladenine glycosidase I) |
| Comments | Rv1210, (MTCI364.22), len: 204 aa. Probable tagA, DNA-3-methyladenine glycosidase I (see citation below), similar to several e.g. 3MG1_ECOLI|P05100 DNA-3-methyladenine glycosidase I from Escherichia coli (187 aa), FASTA scores: opt: 530, E(): 1.3e-27, (44.2% identity in 190 aa overlap); similar to Q49957 Mycobacterium leprae cosmid B1756 (192 aa), FASTA scores: opt: 1042, E(): 0, (80.2% identity in 192 aa overlap). |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1353522 | 1354136 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1210|tagA
VSGDGLVRCPWAEVRPGPDAQLYRDYHDNEWGRPLYGRVALFERMSLEAFQSGLSWLIILRKRENFRRAFSGFDIDKIARYTDTDVRRLLADDGIVRNRAKIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSVSTESKAMSRELKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFDQPGCPMAAR
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant