Gene Mb1256
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable protein TatB |
Comments | Mb1256, tatB, len: 131 aa. Equivalent to Rv1224,len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(99.2% identity in 131 aa overlap). Probable tatB,component of twin-arginine translocation protein export system (see citation below for more information). Possible exported protein with hydrophobic stretch at N-terminus. Highly similar to Q49973|U15180 hypothetical protein U1756Y from Mycobacterium leprae (120 aa), FASTA scores: opt: 601, E(): 0, (73.3% identity in 131 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1368707 | 1369102 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1256|tatB MFANIGWGEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIGAGPIPFDSDAT
Bibliography
No article yet recorded