Gene Mb1273
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb33 |
| Comments | Mb1273, -, len: 86 aa. Equivalent to Rv1241, len: 86 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 86 aa overlap). Conserved hypothetical protein, member of family of 16 hypothetical M. tuberculosis proteins including: Rv2871|Q10799|YS71_MYCTU HYPOTHETICAL 13.2 KD PROTEIN CY2 (124 aa), FASTA scores: opt: 172, E(): 9.5e-06, (37.2% identity in 86 aa overlap); Rv2132, Rv3321c, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1385522 | 1385782 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1273|vapb33
MRTTLTLDDDVVRLVEDAVHRERRPMKQVINDALRRALAPPVKRQEQYRLEPHESAVRSGLDLAGFNKLADELEDEALLDATRRAR
Bibliography
No article yet recorded