Gene Rv1241
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin VapB33 |
Comments | Rv1241, (MTV006.13), len: 86 aa. Possible vapB33, antitoxin, part of toxin-antitoxin (TA) operon with Rv1242, see Arcus et al. 2005. Member of family of 16 hypothetical Mycobacterium tuberculosis proteins including: Rv2871|Q10799|YS71_MYCTU hypothetical 13.2 kDa protein CY2 (124 aa), FASTA scores: opt: 172, E(): 9.5e-06, (37.2% identity in 86 aa overlap); Rv2132, Rv3321c, etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1384278 | 1384538 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1241|vapB33 MRTTLTLDDDVVRLVEDAVHRERRPMKQVINDALRRALAPPVKRQEQYRLEPHESAVRSGLDLAGFNKLADELEDEALLDATRRAR
Bibliography
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function