Gene Mb1330
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l31 rpme |
Comments | Mb1330, rpmE, len: 80 aa. Equivalent to Rv1298,len: 80 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 80 aa overlap). Probable rpmE, 50s ribosomal protein L31, highly similar to many e.g. RL31_MYCLE|P45834 50s ribosomal protein L31 from Mycobacterium leprae (84 aa), FASTA scores: opt: 490, E(): 5.5e-28, (89.6% identity in 77 aa overlap). Contains PS01143 Ribosomal protein L31 signature. BELONGS TO THE L31P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1453212 | 1453454 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1330|rpmE MKSDIHPAYEETTVVCGCGNTFQTRSTKPGGRIVVEVCSQCHPFYTGKQKILDSGGRVARFEKRYGKRKVGADKAVSTGK
Bibliography
No article yet recorded