Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation
Product50S ribosomal protein L31 RpmE
CommentsRv1298, (MTCY373.18), len: 80 aa. rpmE, 50s ribosomal protein L31, highly similar to many e.g. RL31_MYCLE|P45834 50s ribosomal protein L31 from Mycobacterium leprae (84 aa), FASTA scores: opt: 490, E(): 5.5e-28, (89.6% identity in 77 aa overlap). Contains PS01143 Ribosomal protein L31 signature. Belongs to the L31P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS14551631455405+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1298|rpmE
MKSDIHPAYEETTVVCGCGNTFQTRSTKPGGRIVVEVCSQCHPFYTGKQKILDSGGRVARFEKRYGKRKVGADKAVSTGK