Gene Mb1349c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | methylated-dna--protein-cysteine methyltransferase ogt (6-o-methylguanine-dna methyltransferase) (o-6-methylguanine-dna-alkyltransferase) |
| Comments | Mb1349c, ogt, len: 165 aa. Equivalent to Rv1316c,len: 165 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 165 aa overlap). Probable ogt,methylated-dna--protein-cysteine methytransferase (EC 2.1.1.63), similar to many e.g. OGT_HAEIN|P44687 Haemophilus influenzae (190 aa), FASTA scores: opt: 405,E(): 6.5e-20, (41.9% identity in 155 aa overlap). Contains PS00374 Methylated-DNA--protein-cysteine methyltransferase active site. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1475169 | 1475666 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1349c|ogt
MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Bibliography
No article yet recorded