Gene Mb1400c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | anti-anti-sigma factor rsfa (anti-sigma factor antagonist) (regulator of sigma f a) |
Comments | Mb1400c, -, len: 128 aa. Equivalent to Rv1365c,len: 128 aa, from Mycobacterium tuberculosis strain H37Rv,(99.2% identity in 128 aa overlap). Conserved hypothetical protein, similar to other Mycobacterium tuberculosis proteins e.g. Rv2638|MTCY441.08 (148 aa), FASTA scores: E(): 0, (53.6% identity in 125 aa overlap); Rv1904,Rv3687c. Weak similarity to putative anti-anti-sigma factors e.g. AF134889|AF134889_1 Streptomyces coelicolor (113 aa), FASTA scores: opt: 137, E(): 0.004, (26.0% identity in 100 aa overlap). |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1535818 | 1536204 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1400c|rsfa MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHKAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT
Bibliography
No article yet recorded