Gene Rv1365c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Regulates negatively Rv3287c|RSBW|USFX. Regulated by redox potential. |
| Product | Anti-anti-sigma factor RsfA (anti-sigma factor antagonist) (regulator of sigma F A) |
| Comments | Rv1365c, (MTCY02B10.29c), len: 128 aa. RsfA, anti-anti-sigma factor (see citation below), similar to other Mycobacterium tuberculosis proteins e.g. Rv2638|MTCY441.08 (148 aa), FASTA scores: E(): 0, (53.6% identity in 125 aa overlap); Rv1904, Rv3687c. Weak similarity to putative anti-anti-sigma factors e.g. AF134889|AF134889_1 Streptomyces coelicolor (113 aa), FASTA scores: opt: 137, E(): 0.004, (26.0% identity in 100 aa overlap). |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1537783 | 1538169 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1365c|rsfA
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT
Bibliography
- Beaucher J et al. [2002]. Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Product Function Regulation Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Parida BK et al. [2005]. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
