Gene Mb1470c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved Proline, Glycine, Valine-rich secreted protein |
| Comments | Mb1470c, -, len: 209 aa. Highly similar to Rv1435c,len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(96.2% identity in 209 aa overlap). Probable conserved Pro-, Gly-, Val-rich secreted protein (see citation below) with a N-terminal signal sequence. Similar at C-terminus to AF017099|AF017099_1 Mycobacterium tuberculosis pGB1 (87 aa), FASTA scores: opt: 550, E(): 2.3e-17, (97.7% identity in 86 aa overlap). Shows some similarity to N-terminus of CPN_DROME|Q02910 calphotin. drosophila melanogaster (865 aa), FASTA scores: opt: 266, E(): 2.5e-05, (37.2% identity in 191 aa overlap). Contains at least five 7 aa imperfect repeats. Also shows similarity to other Mycobacterium tuberculosis proteins e.g. MTCI237.20c (34.7% identity in 193 aa overlap), MTCI65.25c (36.9% identity in 160 aa overlap) and MTCI65.24c (34.2% identity in 196 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, an in-frame insertion of 21 bp leads to a longer product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (209 aa versus 202 aa). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1608649 | 1609278 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1470c|Mb1470c
MTLMAIVNRFNIKVIAGAGLFAAAIALSPDAAADPLMTGGYACIQGMAGDAPVAAGDPVAAGGPAATGACSAALTDMAGVPFVAPGPVPAAAPVPIGAPVPIPGAPVPIPGAPVPIPGAPVPIPGGPVPIPGAPVPVPAVPAPVIPVGTPLIALGPVLAGAPGDGVVSAPIIGMSGVKDALTDPAPAGGPVPGQPVLPGPSASAPAGAR
Bibliography
No article yet recorded