Gene Rv1435c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved proline, glycine, valine-rich secreted protein |
| Comments | Rv1435c, (MTCY493.19), len: 202 aa. Probable conserved Pro-, Gly-, Val-rich secreted protein (see citation below) with a N-terminal signal sequence. Similar at C-terminus to AF017099|AF017099_1 Mycobacterium tuberculosis pGB1 (87 aa), FASTA scores: opt: 550, E(): 2.3e-17, (97.7% identity in 86 aa overlap). Shows some similarity to N-terminus of CPN_DROME|Q02910 calphotin. Drosophila melanogaster (865 aa), FASTA scores: opt: 266, E(): 2.5e-05, (37.2% identity in 191 aa overlap). Contains at least five 7 aa imperfect repeats. Also shows similarity to other Mycobacterium tuberculosis proteins e.g. MTCI237.20c (34.7% identity in 193 aa overlap), MTCI65.25c (36.9% identity in 160 aa overlap) and MTCI65.24c (34.2% identity in 196 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1612342 | 1612950 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1435c|Rv1435c
LTLMAIVNRFNIKVIAGAGLFAAAIALSPDAAADPLMTGGYACIQGMAGDAPVAAGDPVAAGGPAAAGACSAALTDMAGVPFVAPGPVPAAAPVPIGAPVPIPGAPVPIPGAPVPIPGGPVPIPGAPVPVPAVPAPVIPVGTPLIALGPVLAGAPGDGVVSAPIIGMSGVKDALTDPAPAGGPVPGQPVLPGPSASAPAGAR
Bibliography
- Chubb AJ, Woodman ZL, da Silva Tatley FM, Hoffmann HJ, Scholle RR and Ehlers MR [1998]. Identification of Mycobacterium tuberculosis signal sequences that direct the export of a leaderless beta-lactamase gene product in Escherichia coli. Sequence Localization
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant