Gene Mb1475
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable protein-export membrane protein (translocase subunit) secg |
Comments | Mb1475, secG, len: 77 aa. Equivalent to Rv1440,len: 77 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 77 aa overlap). Probable protein-export membrane protein secG, similar to many e.g. P38388|SECG_MYCLE PROBABLE PROTEIN-EXPORT MEMBRANE (77 aa), FASTA scores: opt: 450, E(): 6.7e-24, (96.1% identity in 77 aa overlap). Start changed since original submission (-40 aa). PART OF THE PROKARYOTIC PROTEIN TRANSLOCATION APPARATUS WHICH COMPRISE SECA|Rv3240c, SECD|Rv2587c,SECE|Rv0638, SECF|Rv2586c, SECG AND SECY|Rv0732. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1614165 | 1614398 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1475|secG MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVTGIWLVSIIGVALLIKYR
Bibliography
No article yet recorded