Gene Mb1532
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin mazf4 |
| Comments | Mb1532, -, len: 105 aa. Equivalent to Rv1495, len: 105 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 105 aa overlap). Conserved hypothetical protein, some similarity to Rv1942c|MTCY09F9.22 hypothetical protein from Mycobacterium tuberculosis (109 aa) (0.7% identity in 101 aa overlap) and Rv0659c,Rv1102c. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1683316 | 1683633 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1532|mazf4
MNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDYLGEVTPATMNKINTALATALGLPWP
Bibliography
No article yet recorded