Gene Rv1495 (mt7)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sequence-specific mRNA cleavage |
| Product | Possible toxin MazF4 |
| Comments | Rv1495, (MTCY277.17), len: 105 aa. Possible mazF4, toxin, part of toxin-antitoxin (TA) operon with Rv1494 (See Pandey and Gerdes, 2005; Zhu et al., 2006), some similarity to Rv1942c|MTCY09F9.22 hypothetical protein from Mycobacterium tuberculosis (109 aa) (0.7% identity in 101 aa overlap) and Rv0659c, Rv1102c. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1686570 | 1686887 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1495|mazF4
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDYLGEVTPATMNKINTALATALGLPWP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Zhu L et al. [2006]. Characterization of mRNA interferases from Mycobacterium tuberculosis. Product
- Zhu L et al. [2008]. The mRNA interferases, MazF-mt3 and MazF-mt7 from Mycobacterium tuberculosis target unique pentad sequences in single-stranded RNA. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
