Gene Mb1566
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable lipoprotein signal peptidase lspA |
| Comments | Mb1566, lspA, len: 202 aa. Equivalent to Rv1539,len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 202 aa overlap). Probable lspA,lipoprotein signal peptidase (EC 3.4.23.36), similar to several e.g. LSPA_PSEFL|P17942 (170 aa), FASTA scores: opt: 299, E(): 2.6e-12, (38.3% identity in 167 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1726257 | 1726865 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1566|lspA
MPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDTVGRRKADG
Bibliography
No article yet recorded