Gene Rv1539
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | This protein specifically catalyzes the removal of signal peptides from prolipoproteins [catalytic activity: cleavage of N-terminal leader sequences from membrane prolipoproteins. Hydrolyses XAA-XBB-XBB-|-CYS, in which XAA is hydrophobic (preferably LEU), XBB is often SER or ala, XCC is often GLY or ala, and the CYS is alkylated on sulfur with a diacylglyceryl group]. |
Product | Probable lipoprotein signal peptidase LspA |
Comments | Rv1539, (MTCY48.26c), len: 202 aa. Probable lspA, lipoprotein signal peptidase (see citation below), similar to several e.g. LSPA_PSEFL|P17942 (170 aa), FASTA scores: opt: 299, E(): 2.6e-12, (38.3% identity in 167 aa overlap). Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). |
Functional category | Cell wall and cell processes |
Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1742244 | 1742852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1539|lspA VPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDTVGRRKADG
Bibliography
- Braunstein M and Belisle JT [2000]. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=&dopt=Abstract Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Ribeiro-GuimarĂ£es ML et al. [2007]. Comparative genomics of mycobacterial proteases. Homology
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant