Gene Mb1581
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible regulatory protein |
| Comments | Mb1581, -, len: 202 aa. Equivalent to Rv1556, len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 202 aa overlap). Possible regulatory protein, similar to X86780|SHGCPIR2|g987088 orfY,regulator of antibiotic transport complexes from Streptomyces hygroscopicus (204 aa), FASTA score: opt: 251, E(): 1.7e-10, (33.8% identity in 201 aa overlap) and others. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1745016 | 1745624 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1581|Mb1581
MVGAVTQIADRPTDPSPWSPRETELLAVTLRLLQEHGYDRLTVDAVAASARASKATVYRRWPSKAELVLAAFIEGIRQVAVPPNTGNLRDDLLRLGELICREVGQHASTIRAVLVEVSRNPALNDVLQHQFVDHRKALIQYILQQAVDRGEISSAAISDELWDLLPGYLIFRSIIPNRPPTQDTVQALVDDVILPSLTRSTG
Bibliography
No article yet recorded