Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in a transcriptional mechanism
ProductPossible regulatory protein
CommentsRv1556, (MTCY48.09c), len: 202 aa. Possible regulatory protein, similar to X86780|SHGCPIR2|g987088 orfY, regulator of antibiotic transport complexes from Streptomyces hygroscopicus (204 aa), FASTA score: opt: 251, E(): 1.7e-10, (33.8% identity in 201 aa overlap) and others.
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17609971761605+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1556|Rv1556
MVGAVTQIADRPTDPSPWSPRETELLAVTLRLLQEHGYDRLTVDAVAASARASKATVYRRWPSKAELVLAAFIEGIRQVAVPPNTGNLRDDLLRLGELICREVGQHASTIRAVLVEVSRNPALNDVLQHQFVDHRKALIQYILQQAVDRGEISSAAISDELWDLLPGYLIFRSIIPNRPPTQDTVQALVDDVILPSLTRSTG