Gene Rv1556
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in a transcriptional mechanism |
| Product | Possible regulatory protein |
| Comments | Rv1556, (MTCY48.09c), len: 202 aa. Possible regulatory protein, similar to X86780|SHGCPIR2|g987088 orfY, regulator of antibiotic transport complexes from Streptomyces hygroscopicus (204 aa), FASTA score: opt: 251, E(): 1.7e-10, (33.8% identity in 201 aa overlap) and others. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1760997 | 1761605 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1556|Rv1556
MVGAVTQIADRPTDPSPWSPRETELLAVTLRLLQEHGYDRLTVDAVAASARASKATVYRRWPSKAELVLAAFIEGIRQVAVPPNTGNLRDDLLRLGELICREVGQHASTIRAVLVEVSRNPALNDVLQHQFVDHRKALIQYILQQAVDRGEISSAAISDELWDLLPGYLIFRSIIPNRPPTQDTVQALVDDVILPSLTRSTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
