Gene Mb1642
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED MEMBRANE PROTEIN |
| Comments | Mb1642, -, len: 132 aa. Equivalent to Rv1616, len: 132 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 132 aa overlap). Conserved membrane protein, with some similarity to other hypothetical proteins e.g. AL096884|SC4G6_9 from Streptomyces coelicolor cosmid 4G6 (148 aa), FASTA scores: opt: 245,E(): 1.7e-1 0, (36.7% identity in 128 aa overlap); Q55401|SLL0543 HYPOTHETICAL 16.5 KD PROTEIN from SYNECHOCYSTIS SP (148 aa), FASTA scores: opt: 225, E(): 6.5e-10, (35.9% identity in 117 aa overlap). Has cysteine cluster and contains a rubredoxin signature (PS00202). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1801049 | 1801447 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1642|Mb1642
MEASGRQRRYAAAGSVVLLAGALGYIGLVDPHNSNSLYPPCLFKLLTGWNCPACGGLRMIHDLLHGELAASINDNVFLLVGVPVLASWVLLRRRHGDLALPIPVMIAVAVAVIAWTVLRNLPGFPLVPTISG
Bibliography
No article yet recorded