Gene Mb1662
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | iron-regulated universal stress protein family protein tb15.3 |
| Comments | Mb1662, TB15.3, len: 146 aa. Equivalent to Rv1636,len: 146 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 146 aa overlap). TB15.3, conserved hypothetical protein (see citations below), similar to other hypothetical proteins from diverse organisms e.g. Q57951|MJ0531|Y531_METJA from Methanococcus jannaschii (170 aa), FASTA scores: opt: 188, E(): 6e-06, (32.2% identity in 149 aa overlap); also P42297|YXIE_BACSU hypothetical 15.9 kd protein in bglh-wapa intergenic region precursor from Bacillus subtilis (148 aa), FASTA scores: opt: 162, E(): 0.00025, (30.8% identity in 156 aa overlap). Part of family of Mycobacterium tuberculosis hypothetical proteins (but lacks C-terminal region) including Rv2005c, Rv2623, Rv2026c, Rv1996, etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1827817 | 1828257 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1662|TB15.3
MSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPQHEDARAADILKDESYKVTGTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT
Bibliography
No article yet recorded
