Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductIron-regulated universal stress protein family protein TB15.3
CommentsRv1636, (MTCY01B2.28), len: 146 aa. TB15.3, iron-regulated universal stress protein family protein (see citations below), similar to other hypothetical proteins from diverse organisms e.g. Q57951|MJ0531|Y531_METJA from Methanococcus jannaschii (170 aa), FASTA scores: opt: 188, E(): 6e-06, (32.2% identity in 149 aa overlap); also P42297|YXIE_BACSU hypothetical 15.9 kDa protein in bglh-wapa intergenic region precursor from Bacillus subtilis (148 aa), FASTA scores: opt: 162, E(): 0.00025, (30.8% identity in 156 aa overlap). Part of family of Mycobacterium tuberculosis hypothetical proteins (but lacks C-terminal region) including Rv2005c, Rv2623, Rv2026c, Rv1996, etc.
Functional category-
ProteomicsThe product of this CDS corresponds to spots 5_100 and 5_113 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, spot TB15.3 identified in cell wall by proteomics at the Statens Serum Institute (Denmark), and spot identified in the University of California (USA) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry and Edman degradation (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS18424511842891+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1636|TB15.3
MSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPQHEDARAADILKDESYKVTGTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT
      
Bibliography