Gene Mb1671
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible 23S rRNA methyltransferase tsnR |
| Comments | Mb1671, tsnR, len: 260 aa. Equivalent to Rv1644,len: 260 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 260 aa overlap). Possible tsnR, 23S rRNA methyltransferase (EC 2.1.1.-), similar to several e.g. TSNR_STRLU|P52393 from Streptomyces laurentii (270 aa), FASTA scores: opt: 276, E(): 3.6e-11, (27.6% identity in 261 aa overlap). Also similar to M. tuberculosis hypothetical proteins Rv0881, Rv3579c, and Rv0380c. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1838971 | 1839753 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1671|tsnR
MLTERSARVATAVKLHRHVGRRRAGRFLAEGPNLVAAALARGLVREVFVTEVAARRHELLLAAHEASVHLVTERAAKALSDTVTPAGLVAVCDLPATRLEDVLAGSPQLIAVTVEIREPGNAGTVIRIADAMGAAAVILAGRSVDPYNGKCLRASTGSIFAIPVVVAPDVGAAIADLRAAGLQVLATAVDGEMALDDADRLLAEPTAWLFGPEAHGLSAEIAALADHRVHIPMSGGAESLNVAAAAAICLYESARALGRR
Bibliography
No article yet recorded