Gene Rv1644
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | rRNA modification |
| Product | Possible 23S rRNA methyltransferase TsnR |
| Comments | Rv1644, (MTCY06H11.08), len: 260 aa. Possible tsnR, 23S rRNA methyltransferase, similar to several e.g. TSNR_STRLU|P52393 from Streptomyces laurentii (270 aa), FASTA scores: opt: 276, E(): 3.6e-11, (27.6% identity in 261 aa overlap). Also similar to M. tuberculosis hypothetical proteins Rv0881, Rv3579c, and Rv0380c. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1853606 | 1854388 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1644|tsnR
VLTERSARVATAVKLHRHVGRRRAGRFLAEGPNLVAAALARGLVREVFVTEVAARRHELLLAAHEASVHLVTERAAKALSDTVTPAGLVAVCDLPATRLEDVLAGSPQLIAVTVEIREPGNAGTVIRIADAMGAAAVILAGRSVDPYNGKCLRASTGSIFAIPVVVAPDVGAAIADLRAAGLQVLATAVDGEMALDDADRLLAEPTAWLFGPEAHGLSAEIAALADHRVHILMSGGAESLNVAAAAAICLYESARALGRR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant