Gene Mb1685
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable Arginine repressor argR (AHRC) |
Comments | Mb1685, argR, len: 170 aa. Equivalent to Rv1657,len: 170 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 170 aa overlap). Probable argR, Arginine repressor (alternate gene name: ahrC). Similar to AHRC_BACSU|P17893 arginine hydroximate resistance protein from Bacillus subtilis (149 aa), FASTA scores: opt: 283,E(): 1.8e-11, (34.5% identity in 142 aa overlap); and ARGR_ECOLI|P15282 arginine repressor from Escherichia coli ( 156 aa), FASTA scores: opt: 194, E(): 6.4e-06, (30.8% identity in 146 aa overlap). BELONGS TO THE ARGR FAMILY. |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1856228 | 1856740 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1685|argR MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Bibliography
No article yet recorded