Gene Mb1720
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 2'-o-methyltransferase tlya |
| Comments | Mb1720, tlyA, len: 268 aa. Equivalent to Rv1694,len: 268 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 268 aa overlap). tlyA,cytotoxin/haemolysin homologue (see citations below),almost identical to NP_301968.1|NC_002677 cytotoxin/haemolysin homologue TlyA from Mycobacterium leprae (269 aa). TlyA homologues were also identified by PCR in M. avium, M. bovis BCG, but appeared absent in M. smegmatis, M. vaccae, M. kansasii, M. chelonae and M. phlei (see first citation below). Also highly similar to CAB83047.1|AJ271681 putative haemolysin from Mycobacterium ulcerans (281 aa); and similar to HLYA_TREHY|Q06803 pore-forming haemolysin/cytotoxin virulence determinant from Treponema hyodysenteriae (240 aa), FASTA scores: opt: 514, E():3e-30, (37.3% identity in 236 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1903282 | 1904088 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1720|tlyA
MARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP
Bibliography
No article yet recorded
