Gene Rv1694
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Methylates 16S and 23S rRNA. Also has contact-dependent haemolytic activity; possibly involved in virulence (pore formation). |
| Product | 2'-O-methyltransferase TlyA |
| Comments | Rv1694, (MTCI125.16), len: 268 aa. TlyA, 2'-O-methyltransferase; cytotoxin/haemolysin homologue (see citations below), almost identical to NP_301968.1|NC_002677 cytotoxin/haemolysin homologue TlyA from Mycobacterium leprae (269 aa). TlyA homologues were also identified by PCR in Mycobacterium avium, Mycobacterium bovis BCG, but appeared absent in M. smegmatis, M. vaccae, M. kansasii, M. chelonae and M. phlei (see Wren et al., 1998). Also highly similar to CAB83047.1|AJ271681 putative haemolysin from Mycobacterium ulcerans (281 aa); and similar to HLYA_TREHY|Q06803 pore-forming haemolysin/cytotoxin virulence determinant from Treponema hyodysenteriae (240 aa), FASTA scores: opt: 514, E():3e-30, (37.3% identity in 236 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Transcriptomics | mRNa identified by RT-PCR (see Wren et al., 1998: experiments used bacteria cultured in vitro). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. tuberculosis H37Rv tlyA|Rv1694 mutants are resistant to capreomycin and viomycin (See Maus et al., 2005a; Maus et al., 2005b). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1917940 | 1918746 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1694|tlyA
VARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP
Bibliography
- Wren BW et al. [1998]. Characterization of a haemolysin from Mycobacterium tuberculosis with homology to a virulence factor of Serpulina hyodysenteriae. Sequence Biochemistry Function
- Parish T et al. [2000]. Use of a flexible cassette method to generate a double unmarked Mycobacterium tuberculosis tlyA plcABC mutant by gene replacement. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Maus CE et al. [2005]. Mutation of tlyA confers capreomycin resistance in Mycobacterium tuberculosis. Mutant
- Maus CE et al. [2005]. Molecular analysis of cross-resistance to capreomycin, kanamycin, amikacin, and viomycin in Mycobacterium tuberculosis. Mutant
- Johansen SK et al. [2006]. Capreomycin binds across the ribosomal subunit interface using tlyA-encoded 2'-O-methylations in 16S and 23S rRNAs. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
