Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMethylates 16S and 23S rRNA. Also has contact-dependent haemolytic activity; possibly involved in virulence (pore formation).
Product2'-O-methyltransferase TlyA
CommentsRv1694, (MTCI125.16), len: 268 aa. TlyA, 2'-O-methyltransferase; cytotoxin/haemolysin homologue (see citations below), almost identical to NP_301968.1|NC_002677 cytotoxin/haemolysin homologue TlyA from Mycobacterium leprae (269 aa). TlyA homologues were also identified by PCR in Mycobacterium avium, Mycobacterium bovis BCG, but appeared absent in M. smegmatis, M. vaccae, M. kansasii, M. chelonae and M. phlei (see Wren et al., 1998). Also highly similar to CAB83047.1|AJ271681 putative haemolysin from Mycobacterium ulcerans (281 aa); and similar to HLYA_TREHY|Q06803 pore-forming haemolysin/cytotoxin virulence determinant from Treponema hyodysenteriae (240 aa), FASTA scores: opt: 514, E():3e-30, (37.3% identity in 236 aa overlap).
Functional category-
TranscriptomicsmRNa identified by RT-PCR (see Wren et al., 1998: experiments used bacteria cultured in vitro).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. tuberculosis H37Rv tlyA|Rv1694 mutants are resistant to capreomycin and viomycin (See Maus et al., 2005a; Maus et al., 2005b).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19179401918746+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1694|tlyA
VARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP