Gene Mb1733c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb1733c, -, len: 55 aa. Equivalent to Rv1706A, len: 55 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 55 aa overlap). Conserved hypothetical protein, similar to part of several probable export proteins e.g. Rv0783c|Z80226_28 from Mycobacterium tuberculosis (540 aa), FASTA scores: opt: 125, E(): 0.011,(52.85% identity in 53 aa overlap). Size difference suggests possible gene fragment. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1919823 | 1919990 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1733c|Mb1733c
MGSLAAFKLGWLLSAMAPNVVLLTAFRVPQGLTMLTVFATGQAGQHRCRTFHVTP
Bibliography
No article yet recorded