Gene Rv1706A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv1706A, len: 55 aa. Conserved hypothetical protein, similar to part of several probable export proteins e.g. Rv0783c|Z80226_28 from Mycobacterium tuberculosis (540 aa), FASTA scores: opt: 125, E(): 0.011, (52.85% identity in 53 aa overlap). Size difference suggests possible gene fragment. |
Functional category | Conserved hypotheticals |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1934482 | 1934649 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1706A|Rv1706A MGSLAAFKLGWLLSAMAPNVVLLTAFRVPQGLTMLTVFATGQAGQHRCRTFHVTP
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant