Gene Mb1795A
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb1795A, -, len: 89 aa. Equivalent to Rv1766, len: 89 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 89 aa overlap). Conserved hypothetical protein, highly similar to P54431|YRKD_BACSU Hypothetical 7.0 kDa protein in bltr-spoIIIC intergenic region from Bacillus subtilis (63 aa), FASTA scores: opt: 151, E(): 1.5e-05, (53.3% identity in 45 aa overlap). Also similar to Q9RD62|SCF56.04C|AL133424 Hypothetical protein from Streptomyces coelicolor (92 aa), FASTA scores: opt: 239,E(): 1.3e-11, (62.5% identity in 64 aa overlap). Also some similarity to other Mycobacterium tuberculosis hypothetical proteins e.g. O07434|Rv0190|MTCI28.29 (96 aa), (35.5% identity in 62 aa overlap); P71543|Rv0967 (119 aa), and P71600|Rv0030 (109 aa). Start changed since original submission. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1990177 | 1990446 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1795A|Mb1795A MIGDQDSIAAVLNRLRRAQGQLAGVISMIEQGRDCRDVVTQLAAVSRALDRAGFKIVAAGLKECVSGATASGAAPLSAAELEKLFLALA
Bibliography
No article yet recorded