Gene Rv1766
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1766, (MTCY28.32), len: 89 aa. Conserved protein, highly similar to P54431|YRKD_BACSU Hypothetical 7.0 kDa protein in bltr-spoIIIC intergenic region from Bacillus subtilis (63 aa), FASTA scores: opt: 151, E(): 1.5e-05, (53.3% identity in 45 aa overlap). Also similar to Q9RD62|SCF56.04C|AL133424 Hypothetical protein from Streptomyces coelicolor (92 aa), FASTA scores: opt: 239, E(): 1.3e-11, (62.5% identity in 64 aa overlap). Also some similarity to other Mycobacterium tuberculosis hypothetical proteins e.g. O07434|Rv0190|MTCI28.29 (96 aa), (35.5% identity in 62 aa overlap); P71543|Rv0967 (119 aa), and P71600|Rv0030 (109 aa). Start changed since original submission. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1999737 | 2000006 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1766|Rv1766
VIGDQDSIAAVLNRLRRAQGQLAGVISMIEQGRDCRDVVTQLAAVSRALDRAGFKIVAAGLKECVSGATASGAAPLSAAELEKLFLALA
Bibliography
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
