Gene Mb1814
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable ferredoxin |
| Comments | Mb1814, -, len: 67 aa. Equivalent to Rv1786, len: 67 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 67 aa overlap). Probable ferredoxin (EC 1.-.-.-), similar to others e.g. X63601|FERS_STRGR FERREDOXIN from Streptomyces griseus (65 aa), FASTA scores: opt: 140, E(): 0.001, (38.1% identity in 63 aa overlap); T50943 probable ferredoxin DitA from Pseudomonas abietaniphila (78 aa); BAA84714.1|AB017795 ferredoxin from Nocardioides sp. (69 aa); etc. Also similar to Rv0763c|MTCY369.08 from Mycobacterium tuberculosis (68 aa), FASTA score: (30.6% identity in 62 aa overlap); and Rv0763c. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2015286 | 2015489 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1814|Mb1814
MKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDGVAACPEMALILEEDDAD
Bibliography
No article yet recorded