Gene Rv1786
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| Product | Probable ferredoxin |
| Comments | Rv1786, (MTV049.08), len: 67 aa. Probable ferredoxin, similar to others e.g. X63601|FERS_STRGR ferredoxin from Streptomyces griseus (65 aa), FASTA scores: opt: 140, E(): 0.001, (38.1% identity in 63 aa overlap); T50943 probable ferredoxin DitA from Pseudomonas abietaniphila (78 aa); BAA84714.1|AB017795 ferredoxin from Nocardioides sp. (69 aa); etc. Also similar to Rv0763c|MTCY369.08 from Mycobacterium tuberculosis (68 aa), FASTA score: (30.6% identity in 62 aa overlap); and Rv0763c. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2024828 | 2025031 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1786|Rv1786
VKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDGVAACPEMALILEEDDAD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
